Lineage for d1c7sa3 (1c7s A:338-780)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236929Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (2 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 236930Protein Bacterial chitobiase (beta-N-acetylhexosaminidase) [51551] (1 species)
  7. 236931Species Serratia marcescens [TaxId:615] [51552] (4 PDB entries)
  8. 236933Domain d1c7sa3: 1c7s A:338-780 [29011]
    Other proteins in same PDB: d1c7sa1, d1c7sa2, d1c7sa4
    complexed with cbs, so4; mutant

Details for d1c7sa3

PDB Entry: 1c7s (more details), 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)

SCOP Domain Sequences for d1c7sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7sa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens}
fpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieipglpeltevgg
qrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipeidmpaharaav
vsmearykklhaagkeqeanefrlvdqtdtsnttsvqffnrqsylnpcldssqrfvdkvi
geiaqmhkeagqpiktwhfggaeaknirlgagytdkakpepgkgiidqsnedkpwaksqv
cqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaesskafatsrvgvn
fwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgtrfsderkvfs
fapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqmeymifprals
vaerswhragweqdyragreykg

SCOP Domain Coordinates for d1c7sa3:

Click to download the PDB-style file with coordinates for d1c7sa3.
(The format of our PDB-style files is described here.)

Timeline for d1c7sa3: