Lineage for d1qba_3 (1qba 338-780)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385319Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (3 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 385320Protein Bacterial chitobiase (beta-N-acetylhexosaminidase) [51551] (1 species)
  7. 385321Species Serratia marcescens [TaxId:615] [51552] (4 PDB entries)
  8. 385322Domain d1qba_3: 1qba 338-780 [29009]
    Other proteins in same PDB: d1qba_1, d1qba_2, d1qba_4
    complexed with so4

Details for d1qba_3

PDB Entry: 1qba (more details), 1.85 Å

PDB Description: bacterial chitobiase, glycosyl hydrolase family 20

SCOP Domain Sequences for d1qba_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qba_3 c.1.8.6 (338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens}
fpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieipglpeltevgg
qrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipeidmpaharaav
vsmearykklhaagkeqeanefrlvdptdtsnttsvqffnrqsylnpcldssqrfvdkvi
geiaqmhkeagqpiktwhfggdeaknirlgagytdkakpepgkgiidqgnedkpwaksqv
cqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaesskafatsrvgvn
fwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgtrfsderkvfs
fapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqmeymifprals
vaerswhragweqdyragreykg

SCOP Domain Coordinates for d1qba_3:

Click to download the PDB-style file with coordinates for d1qba_3.
(The format of our PDB-style files is described here.)

Timeline for d1qba_3: