Lineage for d1ehna2 (1ehn A:133-443,A:517-563)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971115Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 971158Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 971159Species Serratia marcescens [TaxId:615] [51545] (11 PDB entries)
    Uniprot P07254 24-563
  8. 971164Domain d1ehna2: 1ehn A:133-443,A:517-563 [29004]
    Other proteins in same PDB: d1ehna1, d1ehna3
    mutant

Details for d1ehna2

PDB Entry: 1ehn (more details), 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1ehna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehna2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwqfpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq

SCOPe Domain Coordinates for d1ehna2:

Click to download the PDB-style file with coordinates for d1ehna2.
(The format of our PDB-style files is described here.)

Timeline for d1ehna2: