Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Chitinase A, catalytic domain [51544] (1 species) |
Species Serratia marcescens [TaxId:615] [51545] (11 PDB entries) Uniprot P07254 24-563 |
Domain d1ehna2: 1ehn A:133-443,A:517-563 [29004] Other proteins in same PDB: d1ehna1, d1ehna3 mutant |
PDB Entry: 1ehn (more details), 1.9 Å
SCOPe Domain Sequences for d1ehna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehna2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi dwqfpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq
Timeline for d1ehna2: