Lineage for d1c93a_ (1c93 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385273Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 385279Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 385287Domain d1c93a_: 1c93 A: [28998]

Details for d1c93a_

PDB Entry: 1c93 (more details), 2.1 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant

SCOP Domain Sequences for d1c93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c93a_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfndqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOP Domain Coordinates for d1c93a_:

Click to download the PDB-style file with coordinates for d1c93a_.
(The format of our PDB-style files is described here.)

Timeline for d1c93a_: