Lineage for d1c90b_ (1c90 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 65132Family c.1.8.5: Type II chitinase [51534] (7 proteins)
  6. 65158Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 65164Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 65169Domain d1c90b_: 1c90 B: [28997]

Details for d1c90b_

PDB Entry: 1c90 (more details), 2.1 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, e132q mutant
PDB Compounds: (B:)

SCOP Domain Sequences for d1c90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c90b_ c.1.8.5 (B:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfddqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOP Domain Coordinates for d1c90b_:

Click to download the PDB-style file with coordinates for d1c90b_.
(The format of our PDB-style files is described here.)

Timeline for d1c90b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c90a_