Lineage for d1c90a_ (1c90 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306421Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 306427Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 306431Domain d1c90a_: 1c90 A: [28996]

Details for d1c90a_

PDB Entry: 1c90 (more details), 2.1 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, e132q mutant

SCOP Domain Sequences for d1c90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c90a_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfddqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOP Domain Coordinates for d1c90a_:

Click to download the PDB-style file with coordinates for d1c90a_.
(The format of our PDB-style files is described here.)

Timeline for d1c90a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c90b_