Lineage for d1c8ya_ (1c8y A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116871Family c.1.8.5: Type II chitinase [51534] (7 proteins)
  6. 116899Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 116905Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 116908Domain d1c8ya_: 1c8y A: [28995]

Details for d1c8ya_

PDB Entry: 1c8y (more details), 2 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, d130a mutant

SCOP Domain Sequences for d1c8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ya_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfadeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOP Domain Coordinates for d1c8ya_:

Click to download the PDB-style file with coordinates for d1c8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c8ya_: