Lineage for d1c8ya_ (1c8y A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.5: Type II chitinase [51534] (6 proteins) 
Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) 
Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries) 
Domain d1c8ya_: 1c8y A: [28995]
Details for d1c8ya_
PDB Entry: 1c8y (more details), 2 Å
PDB Description: endo-beta-n-acetylglucosaminidase h, d130a mutant
SCOP Domain Sequences for d1c8ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ya_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfadeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt
SCOP Domain Coordinates for d1c8ya_:
Click to download the PDB-style file with coordinates for d1c8ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8ya_:
- d1c8ya_ appears in SCOP 1.57
- d1c8ya_ appears in the current release, SCOPe 2.08
View in 3D