Lineage for d1c8ya_ (1c8y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831857Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 2831863Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 2831865Domain d1c8ya_: 1c8y A: [28995]
    complexed with zn; mutant

Details for d1c8ya_

PDB Entry: 1c8y (more details), 2 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, d130a mutant
PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase h

SCOPe Domain Sequences for d1c8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ya_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfadeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOPe Domain Coordinates for d1c8ya_:

Click to download the PDB-style file with coordinates for d1c8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c8ya_: