Lineage for d1c8xa_ (1c8x A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1819776Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1819917Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 1819923Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 1819925Domain d1c8xa_: 1c8x A: [28994]
    complexed with po4; mutant

Details for d1c8xa_

PDB Entry: 1c8x (more details), 2 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, d130e mutant
PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase h

SCOPe Domain Sequences for d1c8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8xa_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfedeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOPe Domain Coordinates for d1c8xa_:

Click to download the PDB-style file with coordinates for d1c8xa_.
(The format of our PDB-style files is described here.)

Timeline for d1c8xa_: