![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (14 proteins) glycosylase family 18 |
![]() | Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) |
![]() | Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries) |
![]() | Domain d1edt__: 1edt - [28993] |
PDB Entry: 1edt (more details), 1.9 Å
SCOP Domain Sequences for d1edt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edt__ c.1.8.5 (-) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H} kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld gvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn ldggdrtadvsaftrelygseavrt
Timeline for d1edt__: