SCOP 1.65: Domain d1edt__: 1edt -

Lineage for d1edt__ (1edt -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)

7. Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)

8. Domain d1edt__: 1edt - [28993]

Details for d1edt__

PDB Entry: 1edt, 1.9 Å

PDB Description: crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition

SCOP Domain Sequences for d1edt__:

Sequence; same for both SEQRES and ATOM records:

>d1edt__ c.1.8.5 (-) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

Timeline for d1edt__:

• d1edt__ first appeared (with stable ids) in SCOP 1.55
  
• d1edt__ appears in SCOP 1.63
  
• d1edt__ appears in SCOP 1.67
  
• d1edt__ appears in the current release, SCOPe 2.08, called d1edta_