Lineage for d1edt__ (1edt -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.5: Type II chitinase [51534] (6 proteins) 
Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) 
Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries) 
Domain d1edt__: 1edt - [28993]
Details for d1edt__
PDB Entry: 1edt (more details), 1.9 Å
PDB Description: crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
SCOP Domain Sequences for d1edt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edt__ c.1.8.5 (-) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt
SCOP Domain Coordinates for d1edt__:
Click to download the PDB-style file with coordinates for d1edt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1edt__:
- d1edt__ appears in SCOP 1.57
- d1edt__ appears in the current release, SCOPe 2.08, called d1edta_
View in 3D