Lineage for d1eoka_ (1eok A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083306Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 2083309Species Flavobacterium meningosepticum, endoglycosidase F3 [TaxId:238] [51542] (2 PDB entries)
  8. 2083310Domain d1eoka_: 1eok A: [28991]
    complexed with so4

Details for d1eoka_

PDB Entry: 1eok (more details), 1.8 Å

PDB Description: crystal structure of endo-beta-n-acetylglucosaminidase f3
PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase f3

SCOPe Domain Sequences for d1eoka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]}
ngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmgsfksykd
ldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkldgisldi
ehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnnkqlqias
gidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvfgayaegg
tnqandvevakwtptqgakggmmiytynsnvsyanavrdavk

SCOPe Domain Coordinates for d1eoka_:

Click to download the PDB-style file with coordinates for d1eoka_.
(The format of our PDB-style files is described here.)

Timeline for d1eoka_: