Lineage for d1hvq__ (1hvq -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306437Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 306438Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 306445Domain d1hvq__: 1hvq - [28987]
    complexed with nag

Details for d1hvq__

PDB Entry: 1hvq (more details), 2.4 Å

PDB Description: crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor

SCOP Domain Sequences for d1hvq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvq__ c.1.8.5 (-) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOP Domain Coordinates for d1hvq__:

Click to download the PDB-style file with coordinates for d1hvq__.
(The format of our PDB-style files is described here.)

Timeline for d1hvq__: