Lineage for d1hvq__ (1hvq -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.5: Type II chitinase [51534] (7 proteins) 
Protein Hevamine A (chitinase/lysozyme) [51535] (1 species) Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (3 PDB entries) 
Domain d1hvq__: 1hvq - [28987]
Details for d1hvq__
PDB Entry: 1hvq (more details), 2.4 Å
PDB Description: crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor
SCOP Domain Sequences for d1hvq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvq__ c.1.8.5 (-) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv
SCOP Domain Coordinates for d1hvq__:
Click to download the PDB-style file with coordinates for d1hvq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hvq__:
- d1hvq__ first appeared (with stable ids) in SCOP 1.55
- d1hvq__ appears in SCOP 1.59
- d1hvq__ appears in the current release, SCOPe 2.08, called d1hvqa_
View in 3D