SCOPe 2.08: Domain d1hvqa_: 1hvq A:

Lineage for d1hvqa_ (1hvq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)

7. Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)

8. Domain d1hvqa_: 1hvq A: [28987]

Details for d1hvqa_

PDB Entry: 1hvq, 2.2 Å

PDB Description: crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor

PDB Compounds: (A:) hevamine a

SCOPe Domain Sequences for d1hvqa_:

Sequence; same for both SEQRES and ATOM records:

>d1hvqa_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

Timeline for d1hvqa_:

• d1hvqa_ first appeared (with stable ids) in SCOP 1.55, called d1hvq__
  
• d1hvqa_ appears in SCOPe 2.07