Lineage for d1llo__ (1llo -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571962Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 572082Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 572083Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 572085Domain d1llo__: 1llo - [28986]
    complexed with ami, naa

Details for d1llo__

PDB Entry: 1llo (more details), 1.85 Å

PDB Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin

SCOP Domain Sequences for d1llo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llo__ c.1.8.5 (-) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOP Domain Coordinates for d1llo__:

Click to download the PDB-style file with coordinates for d1llo__.
(The format of our PDB-style files is described here.)

Timeline for d1llo__: