Lineage for d1llo__ (1llo -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.5: Type II chitinase [51534] (6 proteins) 
Protein Hevamine A (chitinase/lysozyme) [51535] (1 species) Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (3 PDB entries) 
Domain d1llo__: 1llo - [28986]
Details for d1llo__
PDB Entry: 1llo (more details), 1.85 Å
PDB Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
SCOP Domain Sequences for d1llo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llo__ c.1.8.5 (-) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv
SCOP Domain Coordinates for d1llo__:
Click to download the PDB-style file with coordinates for d1llo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1llo__:
- d1llo__ appears in SCOP 1.57
- d1llo__ appears in the current release, SCOPe 2.08, called d1lloa_
View in 3D