Lineage for d1lloa_ (1llo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831873Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 2831874Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 2831879Domain d1lloa_: 1llo A: [28986]
    complexed with ami

Details for d1lloa_

PDB Entry: 1llo (more details), 1.85 Å

PDB Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
PDB Compounds: (A:) hevamine

SCOPe Domain Sequences for d1lloa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lloa_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOPe Domain Coordinates for d1lloa_:

Click to download the PDB-style file with coordinates for d1lloa_.
(The format of our PDB-style files is described here.)

Timeline for d1lloa_: