Lineage for d1qvbb_ (1qvb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082994Protein beta-Glycosidase [51531] (2 species)
  7. 2083016Species Thermosphaera aggregans [TaxId:54254] [51533] (1 PDB entry)
  8. 2083018Domain d1qvbb_: 1qvb B: [28984]

Details for d1qvbb_

PDB Entry: 1qvb (more details), 2.4 Å

PDB Description: crystal structure of the beta-glycosidase from the hyperthermophile thermosphaera aggregans
PDB Compounds: (B:) beta-glycosidase

SCOPe Domain Sequences for d1qvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvbb_ c.1.8.4 (B:) beta-Glycosidase {Thermosphaera aggregans [TaxId: 54254]}
mkfpkdfmigyssspfqfeagipgsedpnsdwwvwvhdpentaaglvsgdfpengpgywn
lnqndhdlaeklgvntirvgvewsrifpkptfnvkvpverdengsivhvdvddkaverld
elankeavnhyvemykdwvergrklilnlyhwplplwlhnpimvrrmgpdrapsgwlnee
svvefakyaayiawkmgelpvmwstmnepnvvyeqgymfvkggfppgylsleaadkarrn
miqaharaydnikrfskkpvgliyafqwfellegpaevfdkfkssklyyftdivskgssi
inveyrrdlanrldwlgvnyysrlvykivddkpiilhgygflctpggispaenpcsdfgw
evypeglylllkelynrygvdlivtengvsdsrdalrpaylvshvysvwkaanegipvkg
ylhwsltdnyewaqgfrqkfglvmvdfktkkrylrpsalvfreiathngipdelqhltli
q

SCOPe Domain Coordinates for d1qvbb_:

Click to download the PDB-style file with coordinates for d1qvbb_.
(The format of our PDB-style files is described here.)

Timeline for d1qvbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qvba_