Lineage for d1gowb_ (1gow B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306253Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 306308Protein beta-Glycosidase [51531] (2 species)
  7. 306309Species Archaeon Sulfolobus solfataricus [TaxId:2287] [51532] (1 PDB entry)
  8. 306311Domain d1gowb_: 1gow B: [28982]

Details for d1gowb_

PDB Entry: 1gow (more details), 2.6 Å

PDB Description: beta-glycosidase from sulfolobus solfataricus

SCOP Domain Sequences for d1gowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gowb_ c.1.8.4 (B:) beta-Glycosidase {Archaeon Sulfolobus solfataricus}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

SCOP Domain Coordinates for d1gowb_:

Click to download the PDB-style file with coordinates for d1gowb_.
(The format of our PDB-style files is described here.)

Timeline for d1gowb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gowa_