Lineage for d1gowb_ (1gow B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19004Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 19045Protein beta-Glycosidase [51531] (2 species)
  7. 19046Species Sulfolobus solfataricus [TaxId:2287] [51532] (1 PDB entry)
  8. 19048Domain d1gowb_: 1gow B: [28982]

Details for d1gowb_

PDB Entry: 1gow (more details), 2.6 Å

PDB Description: beta-glycosidase from sulfolobus solfataricus

SCOP Domain Sequences for d1gowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gowb_ c.1.8.4 (B:) beta-Glycosidase {Sulfolobus solfataricus}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

SCOP Domain Coordinates for d1gowb_:

Click to download the PDB-style file with coordinates for d1gowb_.
(The format of our PDB-style files is described here.)

Timeline for d1gowb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gowa_