![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins) |
![]() | Protein Beta-glucosidase A [51528] (6 species) |
![]() | Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [51530] (1 PDB entry) |
![]() | Domain d1qoxo_: 1qox O: [28979] |
PDB Entry: 1qox (more details), 2.7 Å
SCOP Domain Sequences for d1qoxo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoxo_ c.1.8.4 (O:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus} sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv hvdydtlvrtpkdsfywykgvisrgwldl
Timeline for d1qoxo_: