Lineage for d1qoxm_ (1qox M:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19004Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 protein domains)
  6. 19014Protein Beta-glucosidase A [51528] (2 species)
  7. 19015Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [51530] (1 PDB entry)
  8. 19028Domain d1qoxm_: 1qox M: [28977]

Details for d1qoxm_

PDB Entry: 1qox (more details), 2.7 Å

PDB Description: beta-glucosidase from bacillus circulans sp. alkalophilus

SCOP Domain Sequences for d1qoxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoxm_ c.1.8.4 (M:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus}
sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
hvdydtlvrtpkdsfywykgvisrgwldl

SCOP Domain Coordinates for d1qoxm_:

Click to download the PDB-style file with coordinates for d1qoxm_.
(The format of our PDB-style files is described here.)

Timeline for d1qoxm_: