Lineage for d1qoxj_ (1qox J:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306253Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 306263Protein Beta-glucosidase A [51528] (6 species)
  7. 306264Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [51530] (1 PDB entry)
  8. 306274Domain d1qoxj_: 1qox J: [28974]

Details for d1qoxj_

PDB Entry: 1qox (more details), 2.7 Å

PDB Description: beta-glucosidase from bacillus circulans sp. alkalophilus

SCOP Domain Sequences for d1qoxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoxj_ c.1.8.4 (J:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus}
sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
hvdydtlvrtpkdsfywykgvisrgwldl

SCOP Domain Coordinates for d1qoxj_:

Click to download the PDB-style file with coordinates for d1qoxj_.
(The format of our PDB-style files is described here.)

Timeline for d1qoxj_: