SCOPe 2.06: Domain d2rexc_: 2rex C:

Lineage for d2rexc_ (2rex C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins)
   Pfam PF08337

6. Protein Plexin-B1 [310822] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311089] (2 PDB entries)

8. Domain d2rexc_: 2rex C: [289633]
   Other proteins in same PDB: d2rexb_, d2rexd_
   complexed with ca, gnp, mg, unx

Details for d2rexc_

PDB Entry: 2rex, 2.3 Å

PDB Description: crystal structure of the effector domain of plxnb1 bound with rnd1 gtpase

PDB Compounds: (C:) Plexin-B1

SCOPe Domain Sequences for d2rexc_:

Sequence; same for both SEQRES and ATOM records:

>d2rexc_ d.15.1.10 (C:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]}
yrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldv
ewrsgvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc

Timeline for d2rexc_:

• d2rexc_ is new in SCOPe 2.06-stable
  
• d2rexc_ appears in SCOPe 2.07
  
• d2rexc_ appears in the current release, SCOPe 2.08