Lineage for d1tr1c_ (1tr1 C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306253Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 306263Protein Beta-glucosidase A [51528] (6 species)
  7. 306281Species Bacillus polymyxa [TaxId:1406] [51529] (4 PDB entries)
  8. 306289Domain d1tr1c_: 1tr1 C: [28959]

Details for d1tr1c_

PDB Entry: 1tr1 (more details), 2.2 Å

PDB Description: crystal structure of e96k mutated beta-glucosidase a from bacillus polymyxa, an enzyme with increased thermoresistance

SCOP Domain Sequences for d1tr1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr1c_ c.1.8.4 (C:) Beta-glucosidase A {Bacillus polymyxa}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkesyywyrnvvsnnwletrr

SCOP Domain Coordinates for d1tr1c_:

Click to download the PDB-style file with coordinates for d1tr1c_.
(The format of our PDB-style files is described here.)

Timeline for d1tr1c_: