Lineage for d1tr1a_ (1tr1 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19004Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 19014Protein Beta-glucosidase A [51528] (2 species)
  7. 19032Species Bacillus polymyxa [TaxId:1406] [51529] (3 PDB entries)
  8. 19037Domain d1tr1a_: 1tr1 A: [28957]

Details for d1tr1a_

PDB Entry: 1tr1 (more details), 2.2 Å

PDB Description: crystal structure of e96k mutated beta-glucosidase a from bacillus polymyxa, an enzyme with increased thermoresistance

SCOP Domain Sequences for d1tr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr1a_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkesyywyrnvvsnnwletrr

SCOP Domain Coordinates for d1tr1a_:

Click to download the PDB-style file with coordinates for d1tr1a_.
(The format of our PDB-style files is described here.)

Timeline for d1tr1a_: