Lineage for d1bggd_ (1bgg D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173697Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 173707Protein Beta-glucosidase A [51528] (2 species)
  7. 173725Species Bacillus polymyxa [TaxId:1406] [51529] (4 PDB entries)
  8. 173730Domain d1bggd_: 1bgg D: [28956]

Details for d1bggd_

PDB Entry: 1bgg (more details), 2.3 Å

PDB Description: glucosidase a from bacillus polymyxa complexed with gluconate

SCOP Domain Sequences for d1bggd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bggd_ c.1.8.4 (D:) Beta-glucosidase A {Bacillus polymyxa}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkesyywyrnvvsnnwletrr

SCOP Domain Coordinates for d1bggd_:

Click to download the PDB-style file with coordinates for d1bggd_.
(The format of our PDB-style files is described here.)

Timeline for d1bggd_: