Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins) |
Protein Beta-glucosidase A [51528] (6 species) |
Species Bacillus polymyxa [TaxId:1406] [51529] (4 PDB entries) |
Domain d1bggc_: 1bgg C: [28955] |
PDB Entry: 1bgg (more details), 2.3 Å
SCOP Domain Sequences for d1bggc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bggc_ c.1.8.4 (C:) Beta-glucosidase A {Bacillus polymyxa} tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf rtqvrtpkesyywyrnvvsnnwletrr
Timeline for d1bggc_: