Lineage for d1bgga_ (1bgg A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236751Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 236761Protein Beta-glucosidase A [51528] (3 species)
  7. 236779Species Bacillus polymyxa [TaxId:1406] [51529] (4 PDB entries)
  8. 236781Domain d1bgga_: 1bgg A: [28953]

Details for d1bgga_

PDB Entry: 1bgg (more details), 2.3 Å

PDB Description: glucosidase a from bacillus polymyxa complexed with gluconate

SCOP Domain Sequences for d1bgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgga_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkesyywyrnvvsnnwletrr

SCOP Domain Coordinates for d1bgga_:

Click to download the PDB-style file with coordinates for d1bgga_.
(The format of our PDB-style files is described here.)

Timeline for d1bgga_: