Lineage for d3pbgb_ (3pbg B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116790Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 116791Protein 6-phospho-beta-D-galactosidase, PGAL [51526] (1 species)
  7. 116792Species Lactococcus lactis [TaxId:1358] [51527] (4 PDB entries)
  8. 116797Domain d3pbgb_: 3pbg B: [28952]

Details for d3pbgb_

PDB Entry: 3pbg (more details), 2.7 Å

PDB Description: 6-phospho-beta-galactosidase form-c

SCOP Domain Sequences for d3pbgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pbgb_ c.1.8.4 (B:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie

SCOP Domain Coordinates for d3pbgb_:

Click to download the PDB-style file with coordinates for d3pbgb_.
(The format of our PDB-style files is described here.)

Timeline for d3pbgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pbga_