Lineage for d2pbg__ (2pbg -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19004Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 19005Protein 6-phospho-beta-D-galactosidase, PGAL [51526] (1 species)
  7. 19006Species Lactococcus lactis [TaxId:1358] [51527] (4 PDB entries)
  8. 19009Domain d2pbg__: 2pbg - [28948]

Details for d2pbg__

PDB Entry: 2pbg (more details), 2.5 Å

PDB Description: 6-phospho-beta-d-galactosidase form-b

SCOP Domain Sequences for d2pbg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbg__ c.1.8.4 (-) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghycdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie

SCOP Domain Coordinates for d2pbg__:

Click to download the PDB-style file with coordinates for d2pbg__.
(The format of our PDB-style files is described here.)

Timeline for d2pbg__: