Lineage for d1pbga_ (1pbg A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236751Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 236752Protein 6-phospho-beta-D-galactosidase, PGAL [51526] (1 species)
  7. 236753Species Lactococcus lactis [TaxId:1358] [51527] (4 PDB entries)
  8. 236754Domain d1pbga_: 1pbg A: [28946]

Details for d1pbga_

PDB Entry: 1pbg (more details), 2.3 Å

PDB Description: the three-dimensional structure of 6-phospho-beta galactosidase from lactococcus lactis

SCOP Domain Sequences for d1pbga_:

Sequence, based on SEQRES records: (download)

>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie

Sequence, based on observed residues (ATOM records): (download)

>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiikyqikgvgrrvapdyvprwiiypeglydqimrvkndypnykkiyit
englgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfiwslmdvfswsngye
kryglfyvdfdtqerypkksahwykklaetqvie

SCOP Domain Coordinates for d1pbga_:

Click to download the PDB-style file with coordinates for d1pbga_.
(The format of our PDB-style files is described here.)

Timeline for d1pbga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbgb_