Lineage for d1pbga_ (1pbg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082914Protein 6-phospho-beta-D-galactosidase, PGAL [51526] (1 species)
  7. 2082915Species Lactococcus lactis [TaxId:1358] [51527] (4 PDB entries)
  8. 2082916Domain d1pbga_: 1pbg A: [28946]
    CASP1
    complexed with so4

Details for d1pbga_

PDB Entry: 1pbg (more details), 2.3 Å

PDB Description: the three-dimensional structure of 6-phospho-beta galactosidase from lactococcus lactis
PDB Compounds: (A:) 6-phospho-beta-d-galactosidase

SCOPe Domain Sequences for d1pbga_:

Sequence, based on SEQRES records: (download)

>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie

Sequence, based on observed residues (ATOM records): (download)

>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]}
mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
sdwmqafdgeteiikyqikgvgrrvapdyvprwiiypeglydqimrvkndypnykkiyit
englgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfiwslmdvfswsngye
kryglfyvdfdtqerypkksahwykklaetqvie

SCOPe Domain Coordinates for d1pbga_:

Click to download the PDB-style file with coordinates for d1pbga_.
(The format of our PDB-style files is described here.)

Timeline for d1pbga_: