![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins) |
![]() | Protein Plant beta-glucosidase (myrosinase) [51522] (4 species) |
![]() | Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (9 PDB entries) |
![]() | Domain d1e1ea_: 1e1e A: [28944] |
PDB Entry: 1e1e (more details), 2.5 Å
SCOP Domain Sequences for d1e1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1ea_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1} mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfne pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes akwlkefnta
Timeline for d1e1ea_: