![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein Plant beta-glucosidase (myrosinase) [51522] (4 species) |
![]() | Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (9 PDB entries) Uniprot P49235 |
![]() | Domain d1e1fa_: 1e1f A: [28942] complexed with psg |
PDB Entry: 1e1f (more details), 2.6 Å
SCOPe Domain Sequences for d1e1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1fa_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1 [TaxId: 4577]} mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfne pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes akwlkefnta
Timeline for d1e1fa_: