Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein Plant beta-glucosidase (myrosinase) [51522] (4 species) |
Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (9 PDB entries) Uniprot P49235 |
Domain d1e56a_: 1e56 A: [28940] complexed with bgc, hbo; mutant |
PDB Entry: 1e56 (more details), 2.1 Å
SCOPe Domain Sequences for d1e56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e56a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1 [TaxId: 4577]} lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa kwlkefntak
Timeline for d1e56a_: