Lineage for d1e4la_ (1e4l A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236751Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 236805Protein Plant beta-glucosidase (myrosinase) [51522] (3 species)
  7. 236808Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (7 PDB entries)
  8. 236815Domain d1e4la_: 1e4l A: [28938]

Details for d1e4la_

PDB Entry: 1e4l (more details), 2.2 Å

PDB Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta-glucosidase zm glu191asp

SCOP Domain Sequences for d1e4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4la_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1}
mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
akwlkefnta

SCOP Domain Coordinates for d1e4la_:

Click to download the PDB-style file with coordinates for d1e4la_.
(The format of our PDB-style files is described here.)

Timeline for d1e4la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e4lb_