Lineage for d1e4na_ (1e4n A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 65051Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 65100Protein Plant beta-glucosidase (myrosinase) [51522] (3 species)
  7. 65103Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (6 PDB entries)
  8. 65106Domain d1e4na_: 1e4n A: [28936]

Details for d1e4na_

PDB Entry: 1e4n (more details), 2.1 Å

PDB Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta-glucosidase zmglu e191d in complex with the natural aglycone dimboa

SCOP Domain Sequences for d1e4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4na_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1}
lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi
gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen
giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp
qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd
dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf
fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp
pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld
yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa
kwlkefnta

SCOP Domain Coordinates for d1e4na_:

Click to download the PDB-style file with coordinates for d1e4na_.
(The format of our PDB-style files is described here.)

Timeline for d1e4na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e4nb_