Lineage for d1cbg__ (1cbg -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173697Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 173746Protein Plant beta-glucosidase (myrosinase) [51522] (3 species)
  7. 173747Species Creeping white clover (Trifolium repens) [TaxId:3899] [51524] (1 PDB entry)
  8. 173748Domain d1cbg__: 1cbg - [28933]

Details for d1cbg__

PDB Entry: 1cbg (more details), 2.15 Å

PDB Description: the crystal structure of a cyanogenic beta-glucosidase from white clover (trifolium repens l.), a family 1 glycosyl-hydrolase

SCOP Domain Sequences for d1cbg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbg__ c.1.8.4 (-) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens)}
fkplpisfddfsdlnrscfapgfvfgtassafqyegaafedgkgpsiwdtfthkypekik
drtngdvaideyhrykedigimkdmnldayrfsiswprvlpkgklsggvnreginyynnl
inevlangmqpyvtlfhwdvpqaledeyrgflgrnivddfrdyaelcfkefgdrvkhwit
lnepwgvsmnayaygtfapgrcsdwlklnctggdsgrepylaahyqllahaaaarlyktk
yqasqngiigitlvshwfepaskekadvdaakrgldfmlgwfmhpltkgrypesmrylvr
krlpkfsteeskeltgsfdflglnyyssyyaakapripnarpaiqtdslinatfehngkp
lgpmaasswlciypqgirklllyvknhynnpviyitengrnefndptlslqeslldtpri
dyyyrhlyyvltaigdgvnvkgyfawslfdnmewdsgytvrfglvfvdfknnlkrhpkls
ahwfksflkk

SCOP Domain Coordinates for d1cbg__:

Click to download the PDB-style file with coordinates for d1cbg__.
(The format of our PDB-style files is described here.)

Timeline for d1cbg__: