Lineage for d1dwhm_ (1dwh M:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083019Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 2083049Species White mustard (Sinapis alba) [TaxId:3728] [51523] (18 PDB entries)
  8. 2083065Domain d1dwhm_: 1dwh M: [28930]
    complexed with gol, nag, so4, zn

Details for d1dwhm_

PDB Entry: 1dwh (more details), 2 Å

PDB Description: study on radiation damage on a cryocooled crystal. part 4: structure after irradiation with 27.2*10e15 photons/mm2
PDB Compounds: (M:) myrosinase ma1

SCOPe Domain Sequences for d1dwhm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwhm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]}
eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
vtdrdlkksgqwyqtfisp

SCOPe Domain Coordinates for d1dwhm_:

Click to download the PDB-style file with coordinates for d1dwhm_.
(The format of our PDB-style files is described here.)

Timeline for d1dwhm_: