Lineage for d2his__ (2his -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474700Protein Xylanase A, catalytic core [51514] (8 species)
  7. 474701Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 474708Domain d2his__: 2his - [28918]

Details for d2his__

PDB Entry: 2his (more details), 1.8 Å

PDB Description: cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose

SCOP Domain Sequences for d2his__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2his__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvnaafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqsnlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d2his__:

Click to download the PDB-style file with coordinates for d2his__.
(The format of our PDB-style files is described here.)

Timeline for d2his__: