Lineage for d2xyl__ (2xyl -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.3: beta-glycanases [51487] (14 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Cellulomonas fimi [TaxId:1708] [51520] (8 PDB entries) 
Domain d2xyl__: 2xyl - [28917]
Details for d2xyl__
PDB Entry: 2xyl (more details), 1.9 Å
PDB Description: cellulomonas fimi xylanase/cellulase complexed with 2-deoxy-2-fluoro- xylobiose
SCOP Domain Sequences for d2xyl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xyl__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf
SCOP Domain Coordinates for d2xyl__:
Click to download the PDB-style file with coordinates for d2xyl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xyl__:
- d2xyl__ first appeared (with stable ids) in SCOP 1.55
- d2xyl__ appears in SCOP 1.59
- d2xyl__ appears in the current release, SCOPe 2.08, called d2xyla_
View in 3D