Lineage for d2exoa_ (2exo A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Xylanase A, catalytic core [51514] (8 species) 
Species Cellulomonas fimi [TaxId:1708] [51520] (14 PDB entries)
synonym: beta-1,4-glycanase Cex
Domain d2exoa_: 2exo A: [28912]
Details for d2exoa_
PDB Entry: 2exo (more details), 1.8 Å
PDB Description: crystal structure of the catalytic domain of the beta-1,4-glycanase cex from cellulomonas fimi
PDB Compounds: (A:) exo-1,4-beta-d-glycanaseSCOPe Domain Sequences for d2exoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exoa_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf
SCOPe Domain Coordinates for d2exoa_:
Click to download the PDB-style file with coordinates for d2exoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2exoa_:
- d2exoa_ first appeared (with stable ids) in SCOP 1.55, called d2exo__
- d2exoa_ appears in SCOPe 2.07
View in 3D