Lineage for d1expa_ (1exp A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816176Protein Xylanase A, catalytic core [51514] (8 species)
  7. 816177Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 816181Domain d1expa_: 1exp A: [28911]
    complexed with g2f, glc

Details for d1expa_

PDB Entry: 1exp (more details), 1.8 Å

PDB Description: beta-1,4-glycanase cex-cd
PDB Compounds: (A:) beta-1,4-d-glycanase cex-cd

SCOP Domain Sequences for d1expa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1expa_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d1expa_:

Click to download the PDB-style file with coordinates for d1expa_.
(The format of our PDB-style files is described here.)

Timeline for d1expa_: