Lineage for d1exp__ (1exp -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236693Protein Xylanase A, catalytic core [51514] (6 species)
  7. 236694Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 236697Domain d1exp__: 1exp - [28911]
    complexed with g2f, glc

Details for d1exp__

PDB Entry: 1exp (more details), 1.8 Å

PDB Description: beta-1,4-glycanase cex-cd

SCOP Domain Sequences for d1exp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exp__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d1exp__:

Click to download the PDB-style file with coordinates for d1exp__.
(The format of our PDB-style files is described here.)

Timeline for d1exp__: