Lineage for d1expa_ (1exp A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Xylanase A, catalytic core [51514] (8 species) 
Species Cellulomonas fimi [TaxId:1708] [51520] (14 PDB entries)
synonym: beta-1,4-glycanase Cex
Domain d1expa_: 1exp A: [28911]
Details for d1expa_
PDB Entry: 1exp (more details), 1.8 Å
PDB Description: beta-1,4-glycanase cex-cd
PDB Compounds: (A:) beta-1,4-d-glycanase cex-cdSCOPe Domain Sequences for d1expa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1expa_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf
SCOPe Domain Coordinates for d1expa_:
Click to download the PDB-style file with coordinates for d1expa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1expa_:
- d1expa_ first appeared (with stable ids) in SCOP 1.55, called d1exp__
- d1expa_ appears in SCOPe 2.07
View in 3D